SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G060857_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G060857_P01
Domain Number 1 Region: 10-158
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.95e-28
Family Cap-Gly domain 0.00091
Further Details:      
 
Domain Number 2 Region: 135-377
Classification Level Classification E-value
Superfamily L domain-like 7.65e-23
Family Ngr ectodomain-like 0.042
Further Details:      
 
Domain Number 3 Region: 454-542
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000265
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G060857_P01   Gene: GRMZM2G060857   Transcript: GRMZM2G060857_T01
Sequence length 545
Comment seq=translation; coord=5:84832046..84838967:1; parent_transcript=GRMZM2G060857_T01; parent_gene=GRMZM2G060857
Sequence
MPSCPPRRPVMSSTTAAAFRLGQRVHAAGDPRRLGTVRYLGPVEGHGGVWVGVDWDDGAG
GRHDGSLAGRRYFVAVGECSATFARPTALSGGISLPDALRLRYRVQDFTKEEQDEMYVFS
TSQKRVSVEFVGTDKVQEKLNNFNELASASVSYMGVSSIGAPNELNSLVPNLKLLDLTGN
LFSQWQDIFSLCQALASLEVLNLTNNTMENDVVETPMLENIRILVLNNCGVTWELVEKIK
VSFSCISELHLMSNRLNMIMTLDGKFVQGFNTLRLLNLEDNHIDSWDEIVKLSYLRSLEQ
LHLNKNRLKHVKYPSNLSPDGPIDDAAAVPFENLQVLLLGSNDIDDFSSVDSLNLFPSLR
DVRLSDNPVADPAKGGAPRFVLVARLGKVGILNGSEISPRERRESEIRYVRLVMGKIESN
DQEEIRRLHPRFAELKSFHGIEDEKPTSSISGPQKMASGLISITLKCVGPSMGEKQPLTK
KLPATTTVGKLKSLCESFFKLKDIKVKLFVEEEGCPLPQPVEEDTASLMELGIGSGATIV
VDEES
Download sequence
Identical sequences A0A1D6H1K6
XP_008681506.1.34533 GRMZM2G060857_P01 GRMZM2G060857_T01|PACid:20877883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]