SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G075247_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G075247_P01
Domain Number 1 Region: 542-829
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-81
Family Protein kinases, catalytic subunit 0.0000879
Further Details:      
 
Domain Number 2 Region: 69-172,204-234
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-24
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 
Weak hits

Sequence:  GRMZM2G075247_P01
Domain Number - Region: 363-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00667
Family Hairpin loop containing domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G075247_P01   Gene: GRMZM2G075247   Transcript: GRMZM2G075247_T01
Sequence length 878
Comment seq=translation; coord=1:221793164..221797678:-1; parent_transcript=GRMZM2G075247_T01; parent_gene=GRMZM2G075247
Sequence
MRRRRCPLLAAVLFLFLLPLFHRHHAASGTDTDTVTLAAPLMGNRTLVSAGSAKYVLGFF
APDPESGRAYLGIWFNGIPARTVVWVANRESPVLGGVGAAALRVLANGSLAIVVVNETDT
ANYDQQPVVWATPPPATASGSNATAQLLDNGNLVLRVPGAGVVWQSFDHPTDTLLPGMKL
GIDFRTGLDRRMVSWRAAGDPSPGEYSFRLDPRGSPELFLYRGSARVYGSGPWNGYQFTG
VPNLKSNSLLTFRFVSAADEAYYSYGVVDSAAVLTRFVLDSSGQIQRLMWIDMTRSWSLF
WSYPLDECDGYRACGPYGVCSVERSPICGCAPGFDPRFPKEWALRDGSGGCRRRTDLACA
GDGFAALTNMKLPESANATVDMSLTLDQCREACLRNCACRAYAGANVSAQGATGCFLWTG
DLLDMRQFGKGGQNLFVRLAASDLPLSSSSPADTDGRTKRLVEIIVPSVAAPALLLLAGL
CICAVRTRRRRTKEKEAIPLALLRDAQRQSAPFGRRNQIAASTDAQDESLHDGQQGGSQD
CDLPSFDVETIQAATGNFSAHSKIGQGGFGPVYMGKLDSGQDIAVKRLSRRSTQGLREFK
NEVKLIAKLQHRNLVRLLGCCIDGSERMLVYEYMHNRSLNTFLFNEEKQPMLSWEKRFSI
INGIARGILYLHQDSALRIIHRDLKASNILLDKDMNPKISDFGVARIFGTDQTAAYTKKV
VGTYGYMSPEYAMDGVFSTKSDVFSFGVLVLEIVSGKKNRGFYHTELDLNLLRYAWRLWK
DGESLEFMDQSIADTSNAAEVLKCIQIGLLCVQEQPKRRPTMSAVTTMLTCENPTLPEPC
EPAFSTGRNHDDDDEDPEAKACRSNSASSWTCTVVEGR
Download sequence
Identical sequences A0A1D6KQI3
GRMZM2G075247_P01 GRMZM2G075247_T01|PACid:20871285 XP_008664739.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]