SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G104618_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G104618_P01
Domain Number 1 Region: 103-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000432
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G104618_P01   Gene: GRMZM2G104618   Transcript: GRMZM2G104618_T01
Sequence length 325
Comment seq=translation; coord=9:138514301..138515549:1; parent_transcript=GRMZM2G104618_T01; parent_gene=GRMZM2G104618
Sequence
MQMQLSVPPQVVVCLALAFLLPCHATATAPAGTIRRVTKQQILASIPPHWDENPVLFLTS
PSGKYAAYFMRSQTEPGAGGLGADFCYVEVLDTTAPGAEGRSVWESECMAVSTVNTCALV
FSWNGLEVFDGSTSVWHTHDAQSDDQNFLQTLQLVDQGDMRILDKGGELAWKASDEPRAA
QRCGMPGSPGLASALPPFAEPIGHGSSDLPFGQGDAYGNGVGVGVGVGAGGAAQPEAPLA
APLPQPESLPLAPLPQEADQFGGAAAAAAGQGQTVQDVGQTFGFGNQPLVDNSPYDSGAL
KHGCSLVGNSVALGLSVAVAMGLGL
Download sequence
Identical sequences K7WFA5
XP_008660346.1.34533 GRMZM2G104618_P01 GRMZM2G104618_T01|PACid:20839686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]