SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G110402_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G110402_P03
Domain Number 1 Region: 166-239
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 266-297
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000785
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 97-128
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000406
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 32-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000576
Family CCCH zinc finger 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G110402_P03   Gene: GRMZM2G110402   Transcript: GRMZM2G110402_T03
Sequence length 301
Comment seq=translation; coord=6:98505255..98508372:1; parent_transcript=GRMZM2G110402_T03; parent_gene=GRMZM2G110402
Sequence
MDTGRKRTAPEGANGAGGPKRARESETTGVGSKSKPCTKFFSTAGCPFGASCHFLHNFPG
GYQAVSKMTNLGGPPVPAPPGRMPMGPGGPDGPPSPAVKTRMCNKYNTAEGCKWGSKCHF
AHGERELGKPLQMDNPMGPPPMGPGPNGHFMPPPMPFPDMVPPSTFGASATAKISVDASL
AGAIIGKGGTNTKHISRVTGAKLAIRDNEADPNHKNIELEGTFDQIKHASAMVTELIVRI
SGKPPPQAKNNPGRGPGSHAGGPGSNFKTKLCENFNKGSCTFGDRCHFAHGEGELRKPAA
A
Download sequence
Identical sequences B4FAX8 K4JRV1
NP_001130889.1.34533 GRMZM2G110402_P02 GRMZM2G110402_P03 GRMZM2G110402_T02|PACid:20824505 GRMZM2G110402_T03|PACid:20824506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]