SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G115705_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G115705_P01
Domain Number 1 Region: 508-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-73
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 76-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.02e-26
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  GRMZM2G115705_P01
Domain Number - Region: 357-398
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0373
Family Anti-platelet protein 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G115705_P01   Gene: GRMZM2G115705   Transcript: GRMZM2G115705_T01
Sequence length 833
Comment seq=translation; coord=2:7102258..7105849:1; parent_transcript=GRMZM2G115705_T01; parent_gene=GRMZM2G115705
Sequence
MDTIFVHLLLLSFMILRPIAIAADVPESDTLGKGRNITDGETLVSADGTFTLGFFSPGAS
TKRYLGIWFSASSVAVCWVANGGRPVNGNSGVLVVRDTGSLLLLDGSGQTIWSSNSTSSS
SSAEAQLLNSGNLVVRDGGSSSSSDAILWQSFDHPSNTLLSGMKLGKNKWTGAEWYLTSW
RSADDPSPGAYRRALDTSGLPELVVWEGNVRTYRTGPWNGRWFSGVPEVSAYRNLIWYQV
TTSPAEVSYGYTSNPGAALTRVVLTDAGVAKRLVWDAGARTWQTFFQGPRDVCDAYGKCG
AFGLCDAGAASTWFCTCLTGFSPASPPAWSLRDTSGGCKRNVKLDCANNGSGTTTTTDGF
LLVRGVKLPDTHNATVDMSITVEDCAARCLANCSCLAYAAADIRGGDVRSGCVMWTDDIV
DLRYVDKGQDLYLRLARSELPAAAGPSPQRPFRTAPVVGASAAAVAVVLIVLSVVLVIRR
RRRPIIPAAQSASPSVPSTELRRPPSVPSVDLSSLRRATNDFSADNVIGRGGFSTVFEGN
LADGTKVAVKRLTQSYLTDGGGETFMREVEVMSELKHENLARLLAYCKDGNERILVYEYM
ENRSLNLCIFARDANQRAVLNWERRLEIIVGVARGVAYLHGLSKVVIHRDLKPSNVLLDG
NWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTARGPSLTLKCDVYSFGVVLIEIVS
GQRNSSNQTLVSDARESWSQNKIKENLLDPAVGQPGPEILLRLERCVQVGLLCVQQSPAD
RPSMAEVVAMLTVNGTSSSQIRSHRSAAAAAAATPLATQDASSGAHGDSIYLT
Download sequence
Identical sequences A0A1D6DXF1
GRMZM2G115705_P01 GRMZM2G115705_T01|PACid:20843951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]