SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G117865_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G117865_P01
Domain Number 1 Region: 68-175,207-236
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.28e-26
Family alpha-D-mannose-specific plant lectins 0.0019
Further Details:      
 
Weak hits

Sequence:  GRMZM2G117865_P01
Domain Number - Region: 387-439
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00981
Family Hairpin loop containing domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G117865_P01   Gene: GRMZM2G117865   Transcript: GRMZM2G117865_T01
Sequence length 507
Comment seq=translation; coord=2:194698957..194700703:-1; parent_transcript=GRMZM2G117865_T01; parent_gene=GRMZM2G117865
Sequence
MEWSRPACIPVTAAAVVLLLLLLPRFCSPAGDKLTPGESLLPGETIVSDGGAFALGFFAP
SNATPGRQYVGIWYNNIPVQTVVWVANRDAPVTVGDARSGNSSSSSSSAPSLALANGSAS
TDLVLSDAGGGRVVWTTNTTSSGTGSTAVLLNSGNFVLRSPNGTTLWQSFDHPTDTFIPD
MKVGLRYRTHDGARIVSWRGPGDPSPGTFSYGMDPRTSLQMLMWNGTRTYWRSSAWTGYM
TVSRYHATTGTVIYVAVVDSEDEIYMTFHVNDGAPPTRYVVTGAGRFQLLSWNRDASAWT
TLESWPSRSCSPYGSCGAYGYCDNTLAVATCRCLDGFEPASPAEWSGGVFSRGCRRRSQQ
QALAPCGGEDDGDAFLDMPNMKVPDRFVLLGTNVSSGDECAAECRRNCSCVAYAYANLRR
SSAKGDTARCLVWTADLVDAQMVGALWGVTAETLHLRVPAGFTGPVSSFQYYSFPFVFPR
LLFFVSRPHASSSCNCSPNLATLYVFV
Download sequence
Identical sequences B4FYC6
GRMZM2G117865_P01 GRMZM2G117865_T01|PACid:20849071 NP_001141826.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]