SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G123604_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G123604_P01
Domain Number 1 Region: 505-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-79
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 100-235
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-21
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  GRMZM2G123604_P01
Domain Number - Region: 386-419
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0157
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G123604_P01   Gene: GRMZM2G123604   Transcript: GRMZM2G123604_T01
Sequence length 849
Comment seq=translation; coord=9:47305255..47310503:-1; parent_transcript=GRMZM2G123604_T01; parent_gene=GRMZM2G123604
Sequence
MAPLPPGPEMEVMSGWLWKTALMEVPRKHHSPPKWSVILWMLVTANLWIMCSSSTQKKVL
MPGFSASEMDYIDNDGKFLLSNGYVFGFGFATVSVSDSTYYVLAVVHLPTTSIVWSANAN
SPVSHSDNFVFDKDGNAYLQSGGSTVWTANISGKGATSMQLLDSGNLVVFGKDGSSPLWQ
SFSHPTDTLLSGQSFIEGMSLLSHSNAQNMTYTLEIKSGDMLLYAGFQLPQPYWSALQDN
RVIIDKNGNNNIYSANLSSGSWSFYDQSGLLQSQLVIAQQQGDANTTLAAVLGNDGLINF
YMLQSVNGKSALPITVPQDSCDMPAHCKPYSICNSGTGCQCPSALSSYANCDPGVISPCN
SKNKFQLVQLDSAVGYVGTRFTLPVPKTNLTGCRNACMGNCSCIAVFFDQTSGNCFLFDQ
IGSLQQKDGGKSSLASFIKVSSSNGGSGQGGSSDNGRLTIVIVVIIVGTLAVIGVLVYVG
FCIYRRSHHTPSQDGGGSSEDDGFLHTISGAPTRFTYRQLQDATNNFSDKLGQGGFGSVY
LGTLPDGSRIAVKKLEGMGQGKKEFRSEVTIIGSIHHIHLVKLRGFCAEGAHRLLAYEYM
AKGSLDRWIFQRNEDSSLLDWDTRFSIALGTAKGLAYLHHDCESKIIHCDIKPENVLLDD
NFLAKVSDFGLAKLMTREQSHVFTTLKGTRGYLAPEWITNYAISEKCDVYSYGMVLLEII
SGRKSYDPVEGSEKAHFPSYAFKKLEEGDLRDISDSKLKYKGQDSRIEMAIKVALWCIQE
DFYQRPSMSKVVQMLEGVCDVPQPPMSSHIGYRLYANAFKSSSEEGTSSGMSDYNSDALL
SAVRLSGPR
Download sequence
Identical sequences K7VD35
GRMZM2G123604_P01 GRMZM2G123604_T01|PACid:20838563 NP_001313308.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]