SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G129058_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G129058_P01
Domain Number 1 Region: 478-764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 62-156,188-218
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.8e-26
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  GRMZM2G129058_P01
Domain Number - Region: 359-409
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0275
Family Pan module (APPLE domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G129058_P01   Gene: GRMZM2G129058   Transcript: GRMZM2G129058_T01
Sequence length 790
Comment seq=translation; coord=1:185401798..185404247:-1; parent_transcript=GRMZM2G129058_T01; parent_gene=GRMZM2G129058
Sequence
MALLKKTHPSITLPIFLLHFCAITFGATDTISRTQPLSGDITIVSKEGNFELGFFSPGNN
GNFYVGIWFRTISKRTVIWVANRDIPVSNASSPELAITMDGNLVLNSLGAPIWSSNSTRK
SSRSSTAVLLDSGNLILRDQYNSSDIFWQSFDHPTDTVVSGQWFGIDKITYEYQDSVSWK
NQEDPAPGPFSYHADLVTMSQYVSIWNHSEVYWQSGNWTGKAFTSIPGMPLKSDYIYDFV
NNSRELKFRWTTKDVSVITRVILSNNGQLQRLTWSNDSEEWITGWYFPAALCDVYSVCGP
FGVCRTGSDEQCFCLPGFRPASSRSWRLGAWSQGCVRQTDIQCAESNISSAIKESDAFLK
ITNIKFSQNPVKLKVQSMEGCRSICLSNCSCTAYAHKQDCNIWNSELWDLKQLPNGNTDG
SDMYIRLAASDHVVQDSEKKAHHLRLIVLFAVLGSIFMALCALSITVKMFQRTSSRKAFS
DNYSLVVYDYSFLRHCTKNFSDRVGQGSFGSVFKGLLPDSKPIAVKKLQGMKQGEKQFHT
EVRALGKIHHNNLVHLIGFCLRGAERMLVYDFMVNGSLDAHLFKDEKILDWNTRFLIILG
VAKGLQYLHDECQECIIHCDIKPENVLLDVNFSPKLADFGLAKLMERHFSRALTTMRGTA
GYLAPEWIGGLPITPKADVYSYGMMLFEIISGRRNSELMESGAIRYFPVWAAIRISEGDI
SEILDPRLSAVNFQELERACKVACWCIQDNEAHRPTMRQIVQILQDIQDVSAAPVPVFLK
QLVDGEYISS
Download sequence
Identical sequences A0A1D6KIH3
GRMZM2G129058_P01 GRMZM2G129058_T01|PACid:20869946 XP_008663318.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]