SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G142207_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G142207_P01
Domain Number 1 Region: 505-797
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-74
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 71-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.24e-25
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  GRMZM2G142207_P01
Domain Number - Region: 271-362
Classification Level Classification E-value
Superfamily beta-Barrel protease inhibitors 0.000126
Family Metalloprotease inhibitor 0.027
Further Details:      
 
Domain Number - Region: 357-395
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00118
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G142207_P01   Gene: GRMZM2G142207   Transcript: GRMZM2G142207_T01
Sequence length 811
Comment seq=translation; coord=3:208796379..208799112:1; parent_transcript=GRMZM2G142207_T01; parent_gene=GRMZM2G142207
Sequence
MAALLYLHPYLAVLPLLISPICSGASPWRTMTTGSHMRGEDHDKVTLLSPDATFSCGFHE
VGTNALTFSIWYTPSASASATERTVVWTANPYSAERGQHSPVNKYGSRLSLNRDGNLVLT
DTNGSTVWETKTSSGRHTTAALLDSGNLVIRDSSSGSNKVVWQSFRSPTDTLLPGQELTK
DTRLVSGYHHLYFDNDNVLRMLYDGPEITSIYWPSPDYNALKNGRNRFNSTRVAVLDDLG
TFVSSDGFRIEASDSGPGVKRRITIGYDGNFRMYSLNASTGAWRVTGQAVIQMCYVHGLC
GRNGLCDYLGGLRCRCPPDYEMVDPTNWNRGCKPMFLTTDDGKEFTFVEQPHADYYGFDL
SSNESVPFEACRDMCLNSSACLSFTYKGGDGWCYTKGLLYNGQVFPYFPGDSYMKVPKSF
NSSAAYSSISNQKEALTCGPAGSAELMLGPASMYGTKKDNINWTYLYVFAAVLGALEMLV
IATGWYLFFNKHSIPKSMEDGYKLVTNPFRRFTYRELAEATGKFKEELGRGGAGVVYRGV
LEDKKVVAVKKLTDVRQGEEEFWAEVTLIGRINHINLVRMWGFCSEGTKRLLVYEYVENE
SLDKYLFGERSAESLLGWSQRYKIALGTARGLAYLHHECLEWVVHCDVKPENILLTRDFD
AKIADFGLAKLAKQGSTSLNFTHMRGTMGYMAPEWALNSPISAKVDVYSYGVVLLEIVTG
IRASSGIVLDERQIDFRQFVQEAKHILSTGSVSDIVDDRLQGHFHADQAVAMVKIAFSCL
EERRKRPTMDEIVKVLMSCGDDDDYHPAYSY
Download sequence
Identical sequences A0A1D6NG97
GRMZM2G142207_P01 GRMZM2G142207_T01|PACid:20825098 XP_008675225.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]