SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G151689_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G151689_P01
Domain Number 1 Region: 166-240
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 267-299
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000497
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 99-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000051
Family CCCH zinc finger 0.0022
Further Details:      
 
Domain Number 4 Region: 34-61
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000811
Family CCCH zinc finger 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G151689_P01   Gene: GRMZM2G151689   Transcript: GRMZM2G151689_T01
Sequence length 303
Comment seq=translation; coord=9:97541948..97544820:1; parent_transcript=GRMZM2G151689_T01; parent_gene=GRMZM2G151689
Sequence
MDTGRKRIAPGGANGAGGPKRARESETTQMGVGSKTKPCTKFFSTAGCPFGSNCHFLHNF
PGGYLAVSKMTNLGGPPVPAPPGRMPMGPGGPDGPPSPALKTRLCNKYNTAEGCKWGSKC
HFAHGERELGKPLQMDNSMGAPPMGPGPNGHFMPPPMPIPDMVPHSTFGASATAKISVDA
SLAGAIIGKSGINTKHISRVTGAKLAIRDNEADPNHKNIELEGTFDQIKHASAMVTELIV
RISGKVPPQAKNNPGRGPGSHAGGPASNFKTKLCENFNKGSCTFGDRCHFAHGESELRKP
AAA
Download sequence
Identical sequences B6TSP3
GRMZM2G151689_T03|PACid:20838281 GRMZM2G151689_P01 NP_001150722.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]