SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G152120_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G152120_P01
Domain Number 1 Region: 517-706
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-55
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 63-163,195-232
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-19
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Weak hits

Sequence:  GRMZM2G152120_P01
Domain Number - Region: 373-408
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00286
Family Hairpin loop containing domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G152120_P01   Gene: GRMZM2G152120   Transcript: GRMZM2G152120_T01
Sequence length 723
Comment seq=translation; coord=9:99959509..99963114:-1; parent_transcript=GRMZM2G152120_T01; parent_gene=GRMZM2G152120
Sequence
MLSQHVLTLTIFLFFLVCFCHSLHDRLTSVTPLYPGDKLVSDNGGMFALGFFNLTTVNST
RSLYLGIWYNNIPERTYVWVANRNSPITTPSAKLVLTNTSRLVLSDSEGRVVWATDNSVV
AGGSGTGTGGSGVLRSTGSFELELQLPNGTAGVVWKSLDHPTDTILPTFRLWTNYRAHTA
VRVVAWKGPRDPSAGEFSLSGDPGSRGLQIVIWRGTGTGTAGGRSWRSGVWNGAGAFSSI
NRFVYSQVVDDGGTIYAAYNAAGGPTTHWKLDYTGNVSLRVWNVESSSWSVLFEGPGTGC
LGYGACGPFGYCDATGRDGGVQECKCLDGFEPEDGFFRDFSRGCRRKEALQACGGGGEGG
GGRRHYFLALPGMKVPDKFLYVRNRSFEECAAECDRNCSCTAYAYANLSGIVTMSATSDV
SRCLLWMGELVDTGKDSDLGENLYLRLAGSPGNNNKKKIGSMAMEIVLPVMACLLMLTSC
VCLVTICKSRGTYVHQDTRTRRWNKEAHERSVHGFWDQNPELSCTSFAELKAATNSFHEA
NLLGQGGFGKVYKGTLEDGREVAVKRLSNGSEQGKEQLRNELVLIASLQHKNLVRLLGCC
IHEDEKLLIYEYLPNKSLDKFLFDPALKSMLDWPKRFNIIKGVARGILYLHQDSRMVIIH
RDLKASNILLDAEMDPKISDFGIARIFGCREQQATVTCRLSTLWRASSRSSPTPTASASC
CWR
Download sequence
Identical sequences GRMZM2G152120_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]