SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G168985_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G168985_P01
Domain Number 1 Region: 476-733
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-64
Family Protein kinases, catalytic subunit 0.00035
Further Details:      
 
Domain Number 2 Region: 91-206
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.02e-25
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  GRMZM2G168985_P01
Domain Number - Region: 376-444
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000373
Family Anti-platelet protein 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G168985_P01   Gene: GRMZM2G168985   Transcript: GRMZM2G168985_T01
Sequence length 736
Comment seq=translation; coord=2:7800110..7805040:1; parent_transcript=GRMZM2G168985_T01; parent_gene=GRMZM2G168985
Sequence
MTKTNTMRSHDLHGYSHRHLLVQSSILLFLGTFSAAQAASDILSKGSNLTYGETLVSANG
SFTLGFFSRGVPARRYLGIWFTVSNSSGDAVCWVANRDHPLGDSSGVLAISDTGSLVLLD
GSGRAAWSSNTTAGAGAASPTVKLLESGNLVLLDGNDGGVDDYGVVKLWQSFDHPTNTLL
PGAKIGINLWSGGGWSLTSWRDADDPSPGEFRYTMVRRGLLPEIVTLDSSDAIKYRTGVW
NGRWFSGIPEMNSFSNMFVFQVTVSPSEVSYSYAAKAGAPPSLSRVLLNYTADAVRVVWW
LDKRGWDNFFTGPRDDCDHYNRCGHSGVCNHTAASTTWPCSCVQGFVPVSSSDWDGRDSS
GGCRRNVSLDCGDNGTTDGFVRLPGVKLPDTLNSSLDTSITLDECRARCLANCSCVAYAA
ADVQGGGDDVGTGCIMWPENLTDLRYVAGGQTLYLRQATPPSGRNLLIQMTEAVETAQDP
SVSSIALATVKSATRNFSTRNVIGEGTFGIVYEGKLPRGHPLLHGLAGRTIAVKRLKPIG
DLPDIIVRYFTREMQLMSGLKQHRNVLRLLAYCDEASERILVYEYMHRRSLDAYIFGTPR
ERALLNWCRRLQIIQGIADGVKHLHEGEGSAGNVIHRDLKPANVLLDGGWQAKVADFGTA
KLLVAGATGTRTRIGTPGYMAPEYVQSDGGETTLKCDVYSFGVTLMETLSGRKNCDTPSL
VSEVKTILNCLGRSRC
Download sequence
Identical sequences GRMZM2G168985_P01 GRMZM2G168985_T01|PACid:20845828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]