SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G169704_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G169704_P01
Domain Number 1 Region: 123-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000236
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G169704_P01   Gene: GRMZM2G169704   Transcript: GRMZM2G169704_T01
Sequence length 320
Comment seq=translation; coord=1:120253273..120254776:-1; parent_transcript=GRMZM2G169704_T01; parent_gene=GRMZM2G169704
Sequence
MELLPCIATLLILLISSSLAAATSPVGTIERVTKQQILASIPPGGGPPVLFLTSPSGKYA
AYFVRTHTVPGAGGLGADFCYVEIIDTTTAAGAHGGTVEGEGEGEGEGESEAGAAGAAAG
GTSVWESECRPISTVNTCALLLSWHGLEVFDGSEEVWHGETNTDGTNFLETLELVDDGDM
RIRDKDGELAWRASDEPRHAQHCGAPGSPGLATALPPFAEPLGAHSSNLPFGQEPDGNGH
SAELPQAADVGSGEAAFGAAAGVAGPELGQGEHDSASVFGAQPLVDNSPYDSRAWKEGRG
AHIIAVWVALCVSAVLGGGL
Download sequence
Identical sequences B4FKS5
GRMZM2G169704_P01 NP_001136828.1.34533 GRMZM2G169704_T01|PACid:20867422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]