SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G304897_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G304897_P01
Domain Number 1 Region: 482-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-71
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 81-170
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000197
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Weak hits

Sequence:  GRMZM2G304897_P01
Domain Number - Region: 204-263
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00173
Family alpha-D-mannose-specific plant lectins 0.0088
Further Details:      
 
Domain Number - Region: 269-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 347-378
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0687
Family Hairpin loop containing domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G304897_P01   Gene: GRMZM2G304897   Transcript: GRMZM2G304897_T01
Sequence length 815
Comment seq=translation; coord=1:106628088..106630852:1; parent_transcript=GRMZM2G304897_T01; parent_gene=GRMZM2G304897
Sequence
MASVSLLLCLLLLVPPLAAAQQQMSSFSANNSTWSPTNSNRILVSINREFAAGFVASTSA
RDRYHFAVWVVGSNSTDKAFIWYAHDTASYSPYEGNDTSKLAIDAAGRLTWTAGGNNNAT
IWSLPPPANTTTTPAVLQLNDTGSLVYGAAWSSFAEPTNTLMPGQAMPKGGNDTTLQSVN
GHYRVVNSATLQFNNSMMYANISGGSALLNLTADGKLQFSGSQLIASDQGTTNRVRRLTL
DDDGNLRLYSLVPKTRKWLVVWQVVQELCTIRGTCANGRICVPVGVDSTTCVCPPGYRNA
TPTDPCTPKKRYSGRGDDDTFVRMDFVSFSGAANSSASDPGPLMTKLTPQNLADCERLCR
SNSTCVAFGYKFGGDRTCLQFTGLVDGYWSPATEMSTYLRVVASDNDSNPFTGMTTMIET
VCPVQLALPVPPKESQTTIQNVAIITALFVVELLAGVLSFWAFLRKYSQYREMARTLGLE
YLPAGGPRRFSHAELKQATKDFSNVVGRGAYGTVYRGELPDRRAVAVKQLQGVGGGEAEF
WAEVTIIARMHHLNLVRMWGFCAEKEQRMLVYEYVPNGSLDKYLFAGGGGGGGSGEEDSS
AEQQQQQPLLDLHTRYRIALGVARAIAYLHEECLEWVLHCDIKPENILLEDDFCPKVSDF
GLSKLTSKKEKVTMSRIRGTRGYMAPEWVIHREPITAKADVYSFGMVLLEIVSGRRNYGF
RQESVGSEDWYFPKWAYEKVYVERRIDDILDPRIAATYDDAASVATVERMVKTAMWCLQD
RAEMRPSMGKVSKMLEGSVEITEPVKPTIFCVQDD
Download sequence
Identical sequences A0A1D6KAQ9
GRMZM2G304897_T01|PACid:20866383 GRMZM2G304897_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]