SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G322723_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G322723_P01
Domain Number 1 Region: 99-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-22
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G322723_P01   Gene: GRMZM2G322723   Transcript: GRMZM2G322723_T01
Sequence length 493
Comment seq=translation; coord=3:188689258..188691093:1; parent_transcript=GRMZM2G322723_T01; parent_gene=GRMZM2G322723
Sequence
MRDATRGTHAAAEALAARRPRRAMASPLLCGCALLLYLLGHLATCHAARDTITPSSPLAA
NETLVSGGDGNFALGFFTPPGANSTYLGVWYNKVSLRTVVWVANREAPIAGAVGDNPGAT
LSVSGGGTLAIAAGNGTVVWSVRSASSRRLASPAAQILDNGNLVLKDGAGGGGAVAWEGF
DYPTDTLLPEMKLGIDYVKGKNRTLTSWKSPSDPSTGPVAMVMDTTGDPQVFIWNGGEKV
WRSGPWDGVQFTGVPDTATYSGFTFSFINSAQEVTYSFQVHNASIISHLGVVSSGNYGLL
QRSTWVEAARAWNLYWYAPKDQCDAVSPCGANGVCDTNNMPVCSCLRGFTPRTPAAWALR
DGRDGCVRSTPLDCRRNGTTSTTDGFVAVRHAKVPDTERSAVDWSLTLEQCRQACLRNCS
CTAYASANVSSGGGGRGGGAGGGSGCVMWTTGLTDLRVYPDFGQDLFVRLAASDLGTYTY
ERPPRFVPLISFY
Download sequence
Identical sequences A0A1D6N9Q9
GRMZM2G322723_T01|PACid:20825954 GRMZM2G322723_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]