SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G340654_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G340654_P01
Domain Number 1 Region: 351-636
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.93e-73
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 85-163
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-21
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G340654_P01   Gene: GRMZM2G340654   Transcript: GRMZM2G340654_T01
Sequence length 684
Comment seq=translation; coord=10:101736393..101741616:1; parent_transcript=GRMZM2G340654_T01; parent_gene=GRMZM2G340654
Sequence
MWVAFLLVIGFPFLLTTVVGQLSTTAPPNSWELTNLEAIPMDGAVASMRPVLENSANLYR
TLFGFYTTDGHSFVLSVVFLGPKAPVIWSANPDSPVSSSAVLNFTREGDLLLHEAGGGTV
IWSTGTSGMSVAVAGMKLDDLGNLVLFDRKNSSAWQSFDNPTDTLVLGQSLCRGNSSLSA
KPSITKWPGARVYLSAELDGLQYSFKPAAYTQLFKATAASTNATPNCYAFVNGSFGFPDK
VFSLPLAGSMQLMRVVLFQRSLSFGEDGMSFGGDAGNCLLLSEQKLIMFAEGSANNVSAL
FSIQDGHSAERRNIVIITSTVAGISVASVLGFAVLWKKWREEEEPLFDGIPGTPSRFTFH
ELKAATGNFSTKLGAGGFGSVFRGTIGKQTVAVKRLEGVNQGMEEFLAEVKTIGRIHQLN
LVRLVGFCAEKSHRLLVYEYLSNGSLDTWIFGASLVFSLSWKTRRGIMLAIARGLSYLHE
ECEEKIAHLDIKPQNILLDSKFNAKLSDFGLSKMIDRDQSKVVTRMRGTRGYLAPEWLGS
TITEKADVYSFGIVMVEMICGRRNLDESLPEQSIHLVSLLQERAKSGQLLDLVDSGSDDM
KSNNVEEVMRTMKLAMWCLQVDSSSRPSMSTVAKVLEGAVAMEATPGCIFVPSFASGDDA
AAAVAGSNSNSSYVPSESHLSGPR
Download sequence
Identical sequences GRMZM2G340654_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]