SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G353726_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G353726_P01
Domain Number 1 Region: 500-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-82
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 62-166,198-227
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.63e-27
Family alpha-D-mannose-specific plant lectins 0.0022
Further Details:      
 
Weak hits

Sequence:  GRMZM2G353726_P01
Domain Number - Region: 371-404
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0589
Family Hairpin loop containing domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G353726_P01   Gene: GRMZM2G353726   Transcript: GRMZM2G353726_T01
Sequence length 839
Comment seq=translation; coord=7:141477203..141480634:-1; parent_transcript=GRMZM2G353726_T01; parent_gene=GRMZM2G353726
Sequence
MAFPSSISIYTAALLLLLSTLGASDDRLVPGKPLMPGTIIVSDGGEFAFGFFAPSNSTPE
KLYIGIWYNNVPRLTAVWVANRAAPAISSSAPSLVLTNDSNLVLSDVNGRVLWKTNTTAA
GTGSSSPSPRTANATGSVAVLSNSGNLILRSPTGIMVWQSFDHPTDTLLPTMKIWRSYKT
HEANNLVSWKDADDPSLGTFSLAGETDPFIQWFIRNGSVPEWRSNVWTGFTVSSQFFQAN
TSVGVYLTFTYVRTADEIYMVFTTSDGAPPIRTVMSYSGKLETSVWNRNSSEWTTLVVSP
DYECSRYSYCGPSGYCDHSDATPTCKCLEGFEPVDREGWSSARFSRGCRRKEALRCGDGD
GFLALTDMKVPDKFVRVGRKTFQECAAECSGNCSCVAYAYANLNASAANGDATRCLLWIG
DHQLVDSQKMGVLLYSTAGADSQETLYLRVAGMPGKRTKTNTMRIMLPILAAVIVLTSIL
LIWVCKFRGGLGEEKTSNDSELPFLKFQDILVATDNFSNVFMIGQGGFGKVYKGTLEGGQ
EVAIKRLSRDSDQGTQEFRNEVVLIAKLQHRNLVRLLGCCIDGDEKLLIYEYLPNKSLDA
IIFNCARNAPLDWATRFKIIKGVARGLLYLHHDSRLTIIHRDLKASNVLLDAEMRPKIAD
FGMARIFGDNQENANTKRVVGTYGYMAPEYAMEGIFSVKSDVYSFGVLLLEIVSGIKISS
VDRIPGCPNLIVYAWNLWMDGNAEDLVDKCIVDTCLQDEASLCIHMGLLCVQENPDDRPF
TSSVVFNLESGCTTLPTPNHPAYFSQRNSDIDQMREYSDRGEIECLHCVTKNILPRPMM
Download sequence
Identical sequences GRMZM2G353726_T01|PACid:20831685 GRMZM2G353726_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]