SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G362726_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G362726_P01
Domain Number 1 Region: 871-1167
Classification Level Classification E-value
Superfamily BEACH domain 6.8e-124
Family BEACH domain 0.00000000975
Further Details:      
 
Domain Number 2 Region: 1277-1534
Classification Level Classification E-value
Superfamily WD40 repeat-like 3e-37
Family WD40-repeat 0.0067
Further Details:      
 
Domain Number 3 Region: 711-753,791-855
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-19
Family PreBEACH PH-like domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G362726_P01   Gene: GRMZM2G362726   Transcript: GRMZM2G362726_T01
Sequence length 1550
Comment seq=translation; coord=6:90043350..90059681:1; parent_transcript=GRMZM2G362726_T01; parent_gene=GRMZM2G362726
Sequence
MSERLFKFPLSDNLCAALFSVLSGTSAQQVPQENSEPDPSRDRNCNILSLPPFSLPQILI
CIFRFMHSCKDSSARTRILNLLLGLLDSNSSNIEALMEHSWNSWLETSTKLEVFKDYKSV
SKGDPDDVKADEISLVRNLYSLVLSYYLRFVRGGWHQLDDTANYFLLKTDQGQLSCSDLL
RDILDDIAGSLLHKSVEDNIFLLQPCCDNVLHFLNLIQELLISQMGIRLLFLSPSISEES
SHDNIWKEDIKSTVNDILNTESHGQFTRFSDVNEVSDDWWSFFDKVWSIIRNLNGKGPSK
FIPKDPNVEVASLGQRARGLVESMNVPAAEKVAVVSGGGGIGTALGIKVNRFAEKATTSR
EEIIPRIFFHLVILYLCKAGLENASKCVIQFMSLLPILLISEDDQSKNKLHFLIWSLLIV
RSQYGQLDDSARFHVFSHLILETIIYGKSMLVTNILERDDSVDVNNKETGFILSFIQKNR
VLAAAANEVKHMKAVQADRLKKLQDLRMKLNECSATEIKLAQAIEDEIHLTITAVLSADD
NRKTACQLAFREDQQIIRDKWIHISRALMDERGPWSANPFPNDVVTHWKLDKTEDRWRRR
FKFKRNYKFDERLCQPSQSRNESTATLADQLYISAKITQKMKQFLVKGVRGITEDSSYEQ
FEDTNDASESSQSNPSESQNLNNAADTSDHHASAHYKKEPSSTNGDNDYTKVLCSVRCVF
VTPKRKLAGQLDITRTVMHFSFEFLVEGTGGSSVFSKFKDKKDSDCKNELGGVDRLDGCR
DSMIETNGVLMQNQSNKIKRHKRWNITKIKGVHWTRYLLQYTAMEIFFDDSTAPIFLNFS
SQKDTKNAGTLLVSLRNEALFPKGSTKDKNNIISFVDRRVGLEMAENARERWKRREISNF
EYLVILNTLAGRSYNDLTQYPIFPWVLADYTSEKLDFNKSSTFRDLSKPVGALDENRFKV
FEDRYLSFCDPDIPSFYYGSHYSSMGIVLHYMLRLEPFTTLHLNFQGGKFDHADRLFQSI
ESAYINSLSNTSDVKELIPEFFYMPEFLENSNSYHLGVKQDGEPIGDVALPPWAKGSPEE
FIHINREALESEYVSSNLHNWIDLIFGYKQRGQPAVEAANIFYYVTYEGAVDLENMDDML
HKSAIEDQIANFGQTPIQIFRTKHPRRGPPIPIAHPLYFAPQSLTLTSSVCSTASHMCAI
LFISLLENTVVLMNEGLILSVKLWLTTHLQSGGNFTYSGPQEHSFGIGSDVISPRKIGTF
LAENVKFGRQFLATMQNSRDNYLILCGNWENSFQIISLSDGRIMQSIRQHKDVVSCVAVS
SDGNVVATGSYDTTVMIWHAFRGRPIDKKIRGANFELSEKEQVIVERPVHILCGHDDIIT
CLFVSTELDIVISGSKDGTCIFHTLREGRYVRSIQHPSGVGLSKLVASQHGRVVLYSEND
LSLHMYSINGRHIASSATLGRLNCIELSCSGDFIVCAGELGQIVLRSMHSLGIVWRYDGN
GKTITSLAVTPEECILAGTKNGSLLVFSTETSLLRRGSMQRNKIKPSTSG
Download sequence
Identical sequences GRMZM2G362726_P01 GRMZM2G362726_T01|PACid:20822729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]