SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G384755_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G384755_P01
Domain Number 1 Region: 54-149,181-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-27
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  GRMZM2G384755_P01
Domain Number - Region: 347-387
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0628
Family Hairpin loop containing domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G384755_P01   Gene: GRMZM2G384755   Transcript: GRMZM2G384755_T01
Sequence length 498
Comment seq=translation; coord=8:120496204..120504702:1; parent_transcript=GRMZM2G384755_T01; parent_gene=GRMZM2G384755
Sequence
MVLTLLLLLLLPAASRARDTITPGQPLRGNDTLVSSGAGSFVLGFFSPPGSNSTYVGIWY
AKVPVRTVVWVANRAAPVRGAASESAGATLSVSSECALAVADANATVVWRSLSSSSPRPC
AARIQDDGNLVVSDQRGRVVWQGFDHPTDTLLPGMRLGVDFAAGANMTLTAWASPSDPSP
SPVVAAMDTSGDPEVFIWNGPAKVWRSGPWDGVQFTGVPDTVTYKGMGFSFRFVNDGREA
TYSFQVRDAGIVSRLVLNSTGVGGGLMQRWTWLDVAGAWALYWYAPKDQCDALSPCGPNG
VCDTNKVPACSCLPGFTPRSPASWAMRDGRDGCVRATPLDCANRTDGFLVLPHAKVPDAT
RAVVDFNSSLEQCRQRCLRNCSCTAYASANLTAAPGRRGCVMWTGGLEDLRVYPSFGQEL
YFRLAAADLASKGKSKKVSIVVAIAVSITAALAVLLAITGFYIWRANKTKARKSGDILSL
QNVDLPKGDGKTYFIVSM
Download sequence
Identical sequences GRMZM2G384755_P01 GRMZM2G384755_T01|PACid:20851912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]