SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G391288_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G391288_P01
Domain Number 1 Region: 467-753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-75
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 62-145,177-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.16e-19
Family alpha-D-mannose-specific plant lectins 0.007
Further Details:      
 
Weak hits

Sequence:  GRMZM2G391288_P01
Domain Number - Region: 348-398
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Hairpin loop containing domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G391288_P01   Gene: GRMZM2G391288   Transcript: GRMZM2G391288_T01
Sequence length 779
Comment seq=translation; coord=1:186521121..186523537:-1; parent_transcript=GRMZM2G391288_T01; parent_gene=GRMZM2G391288
Sequence
MALLKKTHPSITLPIFLLHFCAITFGATDTISRTQPLSGDITIVSKEGNFELGFFSPGNN
GNFYVGIWFRTISKRTVIWVANRDIPVSNASSPELAITMDGNLVLNSLGAPIWSSNSTRK
SSRCSIRDQYNSSDIFWQSFDHPTDTVVSGQWFGIDKITHEYQDRVSWKNQEDPAPGPFS
FHADLVTMSQYVSIWNHSEVYWQSGNWTGKAFTSIPGMPLKSDYIYDFVNNSRELKFRWT
TKDVSVITRVILSINGQLQRLTWSNDSDEWITGWYFPAALCDVYSVCGPFGVCRTGSDEQ
CFCLPGFRPASARSWRLGAWSQGCVRQTDIQCAESNISSGIKESDAFLKITNIKFSQNPV
KLKVQSMEGCRSICLSTCSCTAYAHKQDCNIWNSELWDLKQLPNGNTDGSDMYIRLAASD
HVVQDSEKKAHHLRLIVLFAVLGSIFMALCALSITVKMFQRTSSRKAFSDNYSLVVYDYS
FLRHCTKNFSDRVGQGSFGSVFKGLLPDSKPIAVKKLQGMKQGEKQFHTEVRALGKIHHN
NLVHLIGFCLRGAERMLVYDFMVNGSLDAHLFKDEKILDWNTRFLIILGVAKGLQYLHDE
CQECIIHCDIKPENVLLDVNFSPKLADFGLAKLMERHFSRALTTMRGTAGYLAPEWIGGL
PITPKADVYSYGMMLFEIISGRRNSELMESGAIRYFPVRAAIRTSEGDISEILDPRLSAV
NFQELERACKVACWCIQDNEAHRPTMRQIVQILQDIQDVSAAPVPVFLKQLVDGEYISS
Download sequence
Identical sequences A0A1D6KII4
GRMZM2G391288_P01 GRMZM2G391288_T01|PACid:20867667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]