SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G401606_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G401606_P01
Domain Number 1 Region: 513-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-61
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 2 Region: 64-172,204-237
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.41e-22
Family alpha-D-mannose-specific plant lectins 0.0076
Further Details:      
 
Weak hits

Sequence:  GRMZM2G401606_P01
Domain Number - Region: 376-435
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00412
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G401606_P01   Gene: GRMZM2G401606   Transcript: GRMZM2G401606_T01
Sequence length 834
Comment seq=translation; coord=3:15225563..15228166:-1; parent_transcript=GRMZM2G401606_T01; parent_gene=GRMZM2G401606
Sequence
MSVALPIAVVGLLALVGACRSAATDTLSPRQVLAGNDTLVSNNSKFTLGFFKAPDGAAGS
ADKWYLGIWFTAVPGRTTVWVANGANPIIEPDTGSPELAVTGDGDLAVVNNATKLVTWSA
RPAHDANTTTAAAVAVLLNSGNLVLLDASNSSSTAAAAPRRTLWQSFDHPTDTLLPSAKL
GLNRATGASSRLVSRLSSATPSPGPYCFEVDPVAPQLVLRLCDSSPVTTYWATGAWNGRY
FSNIPEMAGDVPNFHLAFVDDASEEYLQFNVTTEATVTRNFVDVTGQNKHQVWLGASKGW
LTLYAGPKAQCDVYAACGPFTVCSYTAVQLCSCMKGFSVRSPMDWEQGDRTGGCVRDAPL
DCSTGNNSNASAPSSTSDGFFSMPSIGLPDNGRTLQNARSSAECSTACLTNCSCTAYSYG
GSQGCLVWQGGLLDAKQPQSNDADYVSDVETLHLRLAATEFQTSGRRKRGVTIGAVTGAC
AAALVLLALAVAVIIRRRKKTKNGRGAAAGGGLTAFSYRELRSATKNFSEKLGQGGFGSV
FKGQLRDSTGVAVKRLDGSFQGEKQFRAEVSSIGVIQHVNLVRLVGFCCEGERRFLVYEH
MPNRSLDIHLFQSGGGVFLDWSTRYQIAVGVARGLSYLHDGCRDRIIHCDVKPENILLGA
SLLPKIADFGMAKFVGRDFSRVLTTMRGTKGYLAPERNAGEQYCTASGSGDDDAAREELA
FFPMEAARELVKGPGVVSVSSLLDGKLCGDADLVEVERACKVACWCIQDDEADRPTMGEV
VQILEGVLDCDMPPLPRLLETIFGRPHSSTEQQTTTVSGTSTSQPFTSGSGSHN
Download sequence
Identical sequences GRMZM2G401606_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]