SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G403789_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G403789_P01
Domain Number 1 Region: 63-163,195-228
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-26
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Weak hits

Sequence:  GRMZM2G403789_P01
Domain Number - Region: 373-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00216
Family Hairpin loop containing domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G403789_P01   Gene: GRMZM2G403789   Transcript: GRMZM2G403789_T01
Sequence length 430
Comment seq=translation; coord=10:32150549..32153040:1; parent_transcript=GRMZM2G403789_T01; parent_gene=GRMZM2G403789
Sequence
MAYLHILIVLLSSLHLILGNHATTTRDTISAGQPLRIHDKLVSQNGRYALGFFEAGSSQN
TSNWYLGIWFNSIPKFTVGWVANRDAPMKNHTSLELKISHDGNLVVANRATDSIVWSTEV
NMNYRNNTIIAVLLNSSNLVLRDDDASNSSSISIWQSFDHPTDSLFQWAKLGWDNATGLN
RRLVSKKNSISPASGLYREELDPSGVNQVVLASLIRSTKPYWASGAWNGNRFNSSPEVSR
NVGFLSFVETTHEKYHTYHVSDEVDVYYNLGVSGQVKVFVWPQGSQDWVLAHAEPRSPCD
VYAACGPYTVCDDGALPHCTCMKGFTVTSVEDWELDDRSSGCSRNTALDCNLSGESSVRS
MDKFLSVPCVSFGQSEHKTDGAKSSGECAQVCLRNCSCTAYSFSNDTCLVWHQELLNIRQ
IQCGAAADSN
Download sequence
Identical sequences GRMZM2G403789_P01 GRMZM2G403789_T01|PACid:20873408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]