SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G411668_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G411668_P01
Domain Number 1 Region: 474-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 58-153,185-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-27
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G411668_P01   Gene: GRMZM2G411668   Transcript: GRMZM2G411668_T01
Sequence length 810
Comment seq=translation; coord=1:27742091..27744893:1; parent_transcript=GRMZM2G411668_T01; parent_gene=GRMZM2G411668
Sequence
MLLILVFLLSFSSLDLQISGATTDTLTLGQSLPWNQTLVSKGGNFELGLFSPGNSKKHYI
GIWFKKVSKQTVVWVANRDSPILDPSASRFTLSNRGELLLHATPSNTLLWSSNASSPSPR
TTVATLQDDGNLVVRSNASSALVAWQSFDHPTDTWLPGARLGYDRARGVHSFLTSWTDAD
NPAPGAFSMEIDPRGQAKFDLLAGGTHQYWTTGVWDGEVFENVPEMRSGYFEGVTYAPNA
SVNFFSYKNRVPGIGNFVLETNGQMQRRQWSPEAGKWILFCSEPHDGCDVYGSCGPFGVC
SNTSSAMCECPTAFAPRSREEWKLGNTASGCVRRTKLDCPNDGFLKLPYAVQLPGGSAEA
AGAPRSDKMCALSCLRDCSCTAYAYEAAKCLVWNGELVSLRTLPNDQGVAGAVVLHVRVA
ASEVPPSAAHHSWRKSMVILSSSVSAVVLLLAGLIIVVAVAVVVRKRRGKGKVTAVQGSL
LLFDYQAVKAAARDFTEKLGSGSFGSVYKGTLPDTTPVAIKKLDGLRQGEKQFRAEVVTL
GMIQHINLVRLRGFCSEGNKRALVYDYMPNGSLDAHLFKNSSGSKVLSWSQRFGIAVGVA
RGLSYLHEKCRECIIHCDIKPENILLDEEMGAKVADFGMAKLVGHDFSRVLTTMRGTMGY
LAPEWLAGAPITAKADVYSFGLLLFELISGRRNNGSSETGSNSAVYFPVHAAVRLHAGDV
VGLLDDKIAGDANVELERVCKVACWCIQDEEGDRPTMGLVVQQLEGVADVGLPPIPSRLH
MLAMMNKCAVGGEAEVEPCSNSGSKIDTEV
Download sequence
Identical sequences A0A1D6JTK4
GRMZM2G411668_P01 GRMZM2G411668_T01|PACid:20866747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]