SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G411668_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G411668_P02
Domain Number 1 Region: 58-153,185-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-28
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G411668_P02   Gene: GRMZM2G411668   Transcript: GRMZM2G411668_T02
Sequence length 326
Comment seq=translation; coord=1:27742164..27744796:1; parent_transcript=GRMZM2G411668_T02; parent_gene=GRMZM2G411668
Sequence
MLLILVFLLSFSSLDLQISGATTDTLTLGQSLPWNQTLVSKGGNFELGLFSPGNSKKHYI
GIWFKKVSKQTVVWVANRDSPILDPSASRFTLSNRGELLLHATPSNTLLWSSNASSPSPR
TTVATLQDDGNLVVRSNASSALVAWQSFDHPTDTWLPGARLGYDRARGVHSFLTSWTDAD
NPAPGAFSMEIDPRGQAKFDLLAGGTHQYWTTGVWDGEVFENVPEMRSGYFEGVTYAPNA
RVARGRADHRQGRRVQLRPAPVRAHLGTPEQRLLGDRVQLRCVLPGARRRQAARGGRGRA
ARRQDRRGCQRGAREGLQGRVLVHPG
Download sequence
Identical sequences GRMZM2G411668_P02 GRMZM2G411668_T02|PACid:20866748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]