SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G418689_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G418689_P01
Domain Number 1 Region: 502-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-73
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 88-200
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.02e-27
Family alpha-D-mannose-specific plant lectins 0.0016
Further Details:      
 
Weak hits

Sequence:  GRMZM2G418689_P01
Domain Number - Region: 380-430
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00589
Family Pan module (APPLE domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G418689_P01   Gene: GRMZM2G418689   Transcript: GRMZM2G418689_T01
Sequence length 827
Comment seq=translation; coord=8:163280751..163284400:1; parent_transcript=GRMZM2G418689_T01; parent_gene=GRMZM2G418689
Sequence
MATRAGRLPTTPAPALLLLLAFPFLLQGVLPSRAGDTVAAGRPLSGGQSLVSKRGKFRLG
FFRPGATDNSSQRWYLGIWYNQLSVHTTVWVANRGTPISDPESSQLSISKDGNMVVLDHS
RSSTAVWSTNVTTGVSSTSTVGVIRDNGNLVLADASNTSAVLWQSFDHSGDTWLPGGKLG
RNKRTGEVTRLVAWKGRDDPTPSLFALELDPRGSSQYLLNWNDSERYWTSGNWTGTAFAA
VPEMTSTGASPVSDYTFGYVDGANESYFTYDVADESVVTRFQVDVTGQIQFLTWVAAAAQ
WVLFWSEPKRQCDVYAVCGPFGLCTENALPSCTCPRGFRERDLAEWMQDDHTAGCARNTA
LQPCGAGAAARDGQKRRRDDDRFYTMPDVRLPSDARSAAAASAHDCELACLRNCSCTAYS
YSGGCSLWYGDLINLQDTTSAGSGTGGGSISIRLAASEFSSNGNTKKLVIGLVVAGSSFV
AAVTAIVLATVLVLRNRRIKSLRTVQGSLVAFTYRDLQLVTNNFSEKLGGGAFGSVFKGV
LPDATLVAVKKLEGVRQGEKQFRAEVSTIGTIQHVNLIRLLGFCSEGSRRLLVYEHMPSG
SLDRHLFDRDQQPGVLSWDARYQIALGVARGLDYLHEKCRDCIIHCDIKPENILLDDAFV
PRVADFGLAKLMGRDFSRVLTTMRGTVGYLAPEWIAGTAVTTKADVFSYGMMLFEIISGR
RNVGQRADGTVDFFPSTAVNRLLDGDVRSAVDSQLGGNADVAEVERACKVACWCVQDAES
LRPSMGMVVQVLEGLVDVNAPPVPRSLMVLADPSKYAVEFFSGLPST
Download sequence
Identical sequences GRMZM2G418689_T01|PACid:20851001 GRMZM2G418689_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]