SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G419290_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G419290_P01
Domain Number 1 Region: 505-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-81
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 61-159,191-220
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-23
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 
Weak hits

Sequence:  GRMZM2G419290_P01
Domain Number - Region: 346-393
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000628
Family Anti-platelet protein 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G419290_P01   Gene: GRMZM2G419290   Transcript: GRMZM2G419290_T01
Sequence length 836
Comment seq=translation; coord=2:7157674..7161324:-1; parent_transcript=GRMZM2G419290_T01; parent_gene=GRMZM2G419290
Sequence
MDMTSLTISILLLLLMIRVCKSDDQLASARPLSPGDLLISKGGVFALGFFSPSGSNTSTS
LYVAIWFHGIPERSRTVVWVANRDSPATTSSSPTLAISNSFDLVLSDSQGRTLWRTQNAA
AAAVHDSGTPLAVLLDTGNLQLQLPNGTVIWQSFDHPTDTILPGMRFLMIHGARPAARLV
SWRGPADPSTGAFSFGLDPVSNLQLMVWHGAEPYCRISVWNGVSVSGGMYTGSPSSIVYQ
TIVNTGDEFYLTYTVSDGSPYFRIMLDHTGTMKLLSWDTNSSSWTLISERPTGGYGLYGS
CGPNAYCDFTGAAPACQCLEGFEPVAADLNSSEGCRRTEPLQCSKASHFVALPGMRVPDK
FVLLRNRSFEQCAAECSKNCSCTAYAYANLSSSGAMEDQSRCLVWTGELVDTWKSINYGE
KLYLRLASPVKTKSNIVKIVVPVVACLLLPTCIALVFLCKFKGTTLSGLFSTCNVIVYMK
RKVSMSHQQGNGYLSTSNRLGDKNDEFPFVSFNDIVAATDNFSDCNMLGRGGFGKVYKGI
LEDGKEVAVKRLSQGSGQGIDEVRNEVVLLVKLQHRNLVRLLGCCIHEEEKLLIYEYLPN
KSLDAFLFDTSRTRVLDWPTRFNIIKGIARGILYLHQDSRLTIIHRDLKASNILLDTEMS
PKISDFGMARIFGGNQQLANTTRVVGTYGYMSPEYVTSGAFSVKSDTYSFGVLLLEIVSG
LKIISTQFIMDFPNLITWKLWEEGNATKLVDSLVAESCPLHEAFRCIHVGLLCVQDNPNA
RPLMSTVVFMLENETTLLPAPKEPVYFSPRNNETEETRRNIEGFLNMSCITTLEGR
Download sequence
Identical sequences GRMZM2G419290_T01|PACid:20845206 GRMZM2G419290_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]