SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G420882_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G420882_P01
Domain Number 1 Region: 587-879
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.81e-74
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 106-234,269-295
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000681
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G420882_P01   Gene: GRMZM2G420882   Transcript: GRMZM2G420882_T01
Sequence length 905
Comment seq=translation; coord=6:23055156..23058118:-1; parent_transcript=GRMZM2G420882_T01; parent_gene=GRMZM2G420882
Sequence
MSYPPSSSPNLPLVLRPPAPAMPPPNNRLCVALAIALVVFSSLHTPAAASAADGDTLAAG
QALAAGDKLVSRNGKFALGFFQFRQALPGGGGTGTSASVVVPSPGWYLGVWFNKIPVCTP
VWIANRDRPITESELKVAQFRVASTDGNNKLLVVATSNTNTSADNSIIIVANTTTNGSSV
HVVLMDTGNLVLLPQTEALLSSASAPAASSSSSSSSSSSSSSSSLWQSFDYPTDVGLPGA
KIGWTKLAGGRYFSRQFISKKSLVDPSPGSYSISIDTNGFMQLTRNAPSVQYWSWTSGSL
GNLVTALTALIDMDPRTKGLLKPGYVATADEVYFTYSITDESASVFVPVDVTGQLKLMLW
SDSKRAWETIYAQPSDFCVTSAVCGPFTVCNGNSGPSPSSFCTCMDTFSIRSPRHWELGD
LTEGCARTTPLDCEAANRSSNGSPAPAGSTDVFHPIAQVALPLPYNSRPIEDATTQNGCE
AACLGDCNCTAYSFSTDGKCSVWNGDLLNVDQADSTISSQGVLYLRLAKSDFQGLSRGNK
RTPTAAIAAGAVGSGILVLAVLALVIWRCNNVPPPLHAGVGDGGGIMAFKHTDLCRATKN
FSDRLGGGGFGSVFKGLLGDSTAVAVKRLDDARQGEKQFRAEVSSVGMIQHINLVRLIGF
CCEGDKRLLVYEHVVNGSLDAHLFQQSSAAVVATALDWSKRYRIAVGVARGLCYLHQSCR
ECIIHCDIKPENILLDASFAPKIADFGMAAFVGRDFSRVLTTFRGTAGYLAPEWLSGVPI
TPKVDVYSFGMVVLEIVSGQRNTPPQALSRSGYYHAAAYFPVQAITKLHEGDLQGLVDPR
LQGDLSLEEAERLFKVAFWCIQDDECDRPTMADVVRVLEGLQELDMPPVPRLLAAITARA
NADFM
Download sequence
Identical sequences GRMZM2G420882_T01|PACid:20821415 GRMZM2G420882_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]