SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G422340_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G422340_P02
Domain Number 1 Region: 466-786
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-82
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 56-150,181-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.46e-25
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Weak hits

Sequence:  GRMZM2G422340_P02
Domain Number - Region: 345-377
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0235
Family Hairpin loop containing domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G422340_P02   Gene: GRMZM2G422340   Transcript: GRMZM2G422340_T02
Sequence length 798
Comment seq=translation; coord=2:7380890..7384243:1; parent_transcript=GRMZM2G422340_T02; parent_gene=GRMZM2G422340
Sequence
MAMAYLPVFVFLFMVVLCQSDDRLTPAKPLLPNEVLISGGGVFALGFFSLKNSSRSYVGI
WYNNIPERTYVWIANRDNPITTNVPGKLVFTNSSDLVLLDSTGRTIWTTTNNYTAGGGGE
TASILLDSGNLVIRLPNGTDIWESFSYPTDTIVPNVNFSLNVASSATLLVAWKGPDDPSS
SDFSMGGDPSSGLQIIVWNGTQPYWRRAAWGGELVHGIFQNNTSFMMYQTVVDTGDGYYM
QLTVPDGSPSIRLTLDYTGMSTFRRWNNNTSSWKIFSQFPYPSCDRYASCGPFGYCDDTV
PVPACKCLDGFEPNGLDSSKGCRRKDELKCGDGDSFFTLPSMKTPDKFLYIKNRSLDQCA
AECRDNCSCTAYAYANLQNVDTTIDTTRCLVSIMHSVIDAAVTLAFSKNKKSTTLKIVLP
IMAGLILLITCTWLVFKPKDKHKSKKSQYTLQHSDASNRFENENLEFPSIALEDIIVATN
DFSDFNMLGKGGFGKVYKAMLEGGKEVAVKRLSKGSTQGVEEFRNEVVLIAKLQHRNLVR
LLDCCIHKDEKLLIYEYLPNKSLDAFLFDATRKSLLDWPSRFKIIKGVARGLLYLHQDSR
LTIIHRDLKASNILLDTEMSPKISDFGMARIFGGNEQHANTTRVVGTYGYMSPEYAMEGS
FSVKSDTYSFGVLLLEIVSGLKIGSPHLIMDYPNLIAYAWSLWEGGNARELVDSSVLVSC
PLQEAVRCIHLGLLCVQDSPNARPLMSSIVFMLENETAPVPTPKRPVYFTTRNYETNQSD
QYMRRSLNNMSITTLEGR
Download sequence
Identical sequences GRMZM2G422340_P02 GRMZM2G422340_T02|PACid:20842569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]