SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G426147_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G426147_P01
Domain Number 1 Region: 306-592
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-73
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 63-122
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000157
Family alpha-D-mannose-specific plant lectins 0.0091
Further Details:      
 
Weak hits

Sequence:  GRMZM2G426147_P01
Domain Number - Region: 187-238
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0251
Family Hairpin loop containing domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G426147_P01   Gene: GRMZM2G426147   Transcript: GRMZM2G426147_T01
Sequence length 618
Comment seq=translation; coord=1:184872804..184874946:-1; parent_transcript=GRMZM2G426147_T01; parent_gene=GRMZM2G426147
Sequence
MALLKKTHPSITLPIFLLHFCAITFGATDTISRTQPLSGDITIVSKEGNFELGFFSPGNN
GNCYVGIWFRTISKRTVIWVANRDIPVSNASSPELAITMDGNLVLNSLGAPIWSSNSTRK
SSRSQEYILYMTSYMTSLTTVASLSFRPASARSWRLGAWSQGCVRQTDIQCAESNISSGI
KESDAFLKITNIKFSQNPVKLKVQSMEGCRSICLSTCSCTAYAHKQDCNIWNIELWDLKQ
LPNGNTDGSDMYIRLAASDHVVQDSEKKAHHLRLIVLFAVLGSIFMALCALSITVKMFQR
TSSRKAFSDNYSLVVYDYSFLRHCTKNFSDRVGQGSFGSVFKGLLPDSKPIAVKKLQGMK
QGEKQFHTEVRVLGKIHHNNLVHLIGFCLRGAERMLVYDFMVNRSLDAHLFKDEKILDWN
TRFLIILGVAKGLQYLHDECQECIIHCDIKPENVLLDVNFSPKLADFGLAKLMDRHFSRA
LTTMRGTAGYLAPEWIGGLPITPKADVYSYRMMLFEIISGRRNSELMESGAIRYFPVWAA
IRISEGDISEILDPRLSAVNFQELERACKVACWCIQDNEAHRPTMRQIVHILQDIQDVSA
APVPVFLKQLVDGEYISS
Download sequence
Identical sequences GRMZM2G426147_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]