SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G461537_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G461537_P01
Domain Number 1 Region: 15-94,159-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000131
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  GRMZM2G461537_P01
Domain Number - Region: 304-340
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000569
Family Pan module (APPLE domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G461537_P01   Gene: GRMZM2G461537   Transcript: GRMZM2G461537_T01
Sequence length 443
Comment seq=translation; coord=4:144433633..144435877:-1; parent_transcript=GRMZM2G461537_T01; parent_gene=GRMZM2G461537
Sequence
MLDLAIVHLPSTFPLWRAIPDRPAPWSTAASLSFDGGLVLTDRAADKVLWSTAATSASAG
DRAVLLNTSNLQIQSTGGSSSPDVVWQSFDYPPKTIVQGQNFTSATKLYSFDRRFAMRLG
SNYFGLHIEPPPSSGGVAAAMYFKHMAMEAKAQIVAGGGPTYARVEPDGFPAMYQREGPP
ADVLSFDTFNRGVRALRRMTLEPNRNLRAYYWNGARWALDYTAINDNDRCELPTTYGAYI
VCAEPSGSCECLANATDGSGYAAAVPASFASNLCGTTGGEVGGLYWAVRRWGVEPVNKEL
LRSEQAASTTDCEARCEHNCSCWGAVYSNRTGVCYVMDYPAQLLVASDDRKMGYFKIMSL
EEEGTRGRGDGRTSGVKAALLVVGVVSVVTAAAFGAYRVWDRRRRSAVDARRQMGAADDG
LSPGPYKNLGSFSSVELTNSFRR
Download sequence
Identical sequences A0A1D6Q5J8
XP_020407781.1.34533 GRMZM2G461537_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]