SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G465987_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G465987_P01
Domain Number 1 Region: 545-850
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-79
Family Protein kinases, catalytic subunit 0.0000934
Further Details:      
 
Domain Number 2 Region: 81-201
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.13e-18
Family alpha-D-mannose-specific plant lectins 0.0083
Further Details:      
 
Weak hits

Sequence:  GRMZM2G465987_P01
Domain Number - Region: 385-441
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0353
Family Pan module (APPLE domain) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G465987_P01   Gene: GRMZM2G465987   Transcript: GRMZM2G465987_T01
Sequence length 882
Comment seq=translation; coord=7:150546996..150551513:1; parent_transcript=GRMZM2G465987_T01; parent_gene=GRMZM2G465987
Sequence
MAHAAAAALALLVFFCAQARDAAVHVVDAAATLSQGQSLGATDKLVSAGGTFELAFFTPT
GGDPSRRYLGVMYAQSTEQTVPWVANRDVPVSAGSAYSATVTAAGELQVLEGDRVVWRTD
NSATTTSPGTAGGEQAANVTLTVLDTGNLQLAAGDGGPVIWQSFDHPADTFLPGMSITLD
RRGGGAVRRTLFTSWRSPADPGTGDFTLGQDPLGSAQLYIWQTTGGQNTTYWRSGQWANT
NFVGVPWRSLYVYGFKLNGDPNNGSGVMSYVFNTYNSSEYRFMLHSNGTETCYMLLATGD
WETVWSQPTIPCQAYNMCGANAQCAAAADGGQAVCTCLTGFEPRNVSEYSNGNWTQGCVR
SSPLPCGGEPNVSGAGAGAGVGVGFADLPGVKLPNFAAWGSTVGDAAACEQSCLGNCSCG
AYSYSTGTGCLTWGQDLLDIYRFPDGEGYDLQIKVPAYLLETGSKRRRWTTVVVAVVVAV
AVLAGCGLLLWKCRRRIKEKLGIVVGSEETKATQPSLLPLREARQDFSGPKQTDQEEAEG
GKKFELPIFSLETVAAATGDFSADNKLGEGGFGHVYKGRLPGAEEVAVKRLSRGSVQGME
EFKNEVILIAKLQHRNLVKLLGCCIQGEEKILVYEYMPNKSLDGFLFDPARRGLLDWKTR
FHIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDHDMIPKISDFGMARIFGGDQNQVNT
NRVVGTLGYMSPEYAMEGLFSVRSDVYSFGILILEIVSGQKNSSFHHMEGSLNIVGYAWQ
LWNADRGERLIDPAILPACSVREALRCVHMALLCVQDHACDRPDIPYVVMALGSDSSVLP
MPKPPTFTLQCTSSSDRDGIFPDKVDESYSACDLTVTMLHGR
Download sequence
Identical sequences A0A1D6IEI3
GRMZM2G465987_P01 GRMZM2G465987_T01|PACid:20835813 XP_008653201.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]