SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G465999_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G465999_P01
Domain Number 1 Region: 452-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-79
Family Protein kinases, catalytic subunit 0.0000773
Further Details:      
 
Domain Number 2 Region: 77-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.22e-28
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G465999_P01   Gene: GRMZM2G465999   Transcript: GRMZM2G465999_T01
Sequence length 788
Comment seq=translation; coord=7:150553454..150557779:1; parent_transcript=GRMZM2G465999_T01; parent_gene=GRMZM2G465999
Sequence
MAAAGARLPLALLLPLFVTFFASPASATDTITANSSLSDGQTLVSAGGVFQLGFFTPASS
TARFLGIWYMGLAPQTVVWVANREAPITGTTASLAINATGSLVLADPSGRVFWSSPQSNM
SSTGSPVGAQLLDSGNFVLQGGGGAVLWQSFDYPSDTLLPGMKLGWDLTTGLDRHLTTWR
STGDPSPGDYTFGFDLRGVPEGFIRRDGTVPVYRNGPWNGLQFSGEPEMEPNNSNFQFEF
VDNASDVYYTFLVDGGGGSGNGGVVSRFVLNQSSVQRYVWPPGGQGWSLYWSLPRDQCDN
YAHCGAFGACDTSGGSAACACVHGFTPASPRDWELRDSSAGCRRLTRLNCTGDGFLPLRG
VKLPDTTNATEDATITVDQCRQRCLANCSCLAYAASSIKGGDSGCIIWSSPLIDIRHFPS
GGQDLFVRLAASDLLQLQDRSKEDEAGQSSDLNVTLFDMDAIALSTDNFAAWNKLGEGGF
GAVYKGQLEGGQAVAVKRLSKYSTQGLGEFKNEVMLIAKLQHVNLVRLLGCCVHGEERML
VYEYMENKSLDNFIFGTDKNRSAQLHWSKRFDIILGIARGLLYLHQDSRYKVIHRDLKAG
NILLDKDMNPKISDFGVARIFGDDTDSHTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGV
LVLEIVSGRKNRGMYSSGEQTSLLSQAWRLWREGNALALLDEAVVRAGTHRSSEVLRCVQ
VALLCVQERPDDRPHMAAVFLALGNPSAVLPQPRHPGYCTDRGSASTDGEWSSTCTVNDV
TVTIVEGR
Download sequence
Identical sequences GRMZM2G465999_T01|PACid:20834627 GRMZM2G465999_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]