SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G471596_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G471596_P01
Domain Number 1 Region: 479-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-74
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 67-161,193-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.24e-29
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  GRMZM2G471596_P01
Domain Number - Region: 355-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00746
Family Pan module (APPLE domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G471596_P01   Gene: GRMZM2G471596   Transcript: GRMZM2G471596_T01
Sequence length 797
Comment seq=translation; coord=10:115408055..115410563:1; parent_transcript=GRMZM2G471596_T01; parent_gene=GRMZM2G471596
Sequence
MHLLAVLCGVIFSLLQLHTPTRSAATDTLSRGGSLAGDETLVSSNGKFALGFFETKSDNS
THNASNSYLGIWFHKVPRLTPVWSANGDNPVSSTASPELMISDDGNLVIIAATGTKVWST
QANITANISVVAVLLADGNLVLRSSTNSSDVFWQSFDHPTDTLLPGAKLGRNKATGLDRR
FVSRRNSNDQAPGVYSIGLAPDGVDESMRLSWRSSTEYWSSGEWNGRYFNGIPEMSDPSY
CNYMFVSSGPEFYFSYTLVNESTAFQVVLDVSGQWMVRVWDWDRNDWITFSYSPRSKCDV
YAVCGAYAVCSSNADPVCSCMKGFSVRSPEDWEMEDRTGGCIRDTPLDCNATSMADRFYP
MPFSRLPSNGMGIQNATSAKSCEGSCLSSCSCTAYSYGQGGCSLWHDDLTNVAPDDTGET
LYLRLAAKEVQSWKHHRHGMVIGVAVGVSAVTATLVFIFLIWRRSSRRSSHPADSDQGGI
GIIAFRYADIKRATNNFTEKLGTGGFGSVFKGCLGESVAIAVKRLDGAHQGEKQFRSEVS
SIGIIQHVNLVKLVGFCCEGDRRLLVYEHMPNRSLDVHLFHQSAHGSGTTGLRWDIRYQI
ALGVARGLAYLHHSCQDCIIHCDIKPQNILLDASFVPKIADFGMAKFLGRDFSRVLTTMR
GTVGYLAPEWISGTAITSKVDVYSYGMVLLEIVSGRRNAGREASTDDDCCHAKCCFPVQV
VDKLLNGGVESVVDASLGGDVNLDDVERVCRVACWCVQDNEYDRPTMVEVVQFLEGLSEP
DMPPMPRLLHAIAGGSP
Download sequence
Identical sequences K7U3E7
XP_008664164.1.34533 GRMZM2G471596_P01 GRMZM2G471596_T01|PACid:20873256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]