SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G473676_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G473676_P01
Domain Number 1 Region: 76-168,199-228
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.77e-26
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G473676_P01   Gene: GRMZM2G473676   Transcript: GRMZM2G473676_T01
Sequence length 345
Comment seq=translation; coord=2:7267904..7272365:1; parent_transcript=GRMZM2G473676_T01; parent_gene=GRMZM2G473676
Sequence
MTHMSVFIIPTYQQGLIAMAYLYLPVLIFQFMVCFCQSVDRLTPAKPLLHGDVLISNGGV
FALGFFSLKNSTSSSYVGIWYNNIPERTYVWIANRDNPITTNAPGKLVFTNSSDLVLLDS
TGHTIWMTKNNITAGEGGTAAILLDSGNFVVQSQNGTDIWESFHYPTDTMVPDVSFSLSS
SDVAKRLVAWKGPDDPSSSNFSMGGDSSSDLQIVTWNGTRPYWRRAAWGGEVTFGTFEGN
TSFMVYETIVDTGDGYYMKLTVSEGSPSIRLTLDYTGMLTFRRWNVNTSSWAVFGQFPST
ACAHYAFCGPFAYCDGTESVPTCKCLDGFEAMVLIFPKDVGERRS
Download sequence
Identical sequences GRMZM2G473676_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]