SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G702026_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G702026_P01
Domain Number 1 Region: 113-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-43
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 547-623
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000422
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G702026_P01   Gene: GRMZM2G702026   Transcript: GRMZM2G702026_T01
Sequence length 677
Comment seq=translation; coord=5:173093899..173099515:-1; parent_transcript=GRMZM2G702026_T01; parent_gene=GRMZM2G702026
Sequence
MAEAGVARGSGSAGDALFRELWHACAGPLVTVPRQGELVYYFPQGHMEQLEASTDQQLDQ
HLPLFNLPHKILCKVVNVELRAETDSDEVYAQIMLQPQTEQSEPTSPDPEPPEPERCNIH
SFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMTQNPPWQELVAKDLHGNEWHFRHIFRG
QPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSVISSHSM
HLGVLATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKMSVGMRFKMRFEGDE
SPERRFSGTIIGMGCMPANSTSPWANSEWRSLKVQWDEPSAILRPDRVSPWEVEPLDRTN
PQPPQPPLRNKRARPPASPSIAPELAPVFGFWKSPAEPAQAFSFSGLQRTQELYHSSPSS
MFSSSLNVGFNPKYEGPTPNTNHLYWTMRETRTESYSASINKAPTEKKQESTTSGCRLFG
IEIGSSAVSPVVTVASVGHDPPPPALSVDAESDQLSQPSHANKATDAPAASSDRSPNETE
SRQARSCTKVIMQGVAVGRAVDLTRLDGYDDLRRKLEEMFDIPGELSASLKKWKVIYTDD
EDDMMLVGDDPWSEFCRMVKRIYIYSYEEAKSLTPKAKLPAIGGDTGVKPDPSKLPPESD
VPQSDSDNSAPVAADKD
Download sequence
Identical sequences C0PAG5 K4JBW9
GRMZM2G702026_P01 GRMZM2G702026_T01|PACid:20881540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]