SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000060 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000060
Domain Number 1 Region: 139-391
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.68e-89
Family Eukaryotic proteases 0.0000582
Further Details:      
 
Domain Number 2 Region: 432-691
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.94e-86
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 3 Region: 765-1014
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.71e-84
Family Eukaryotic proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000060   Gene: ENSTGUG00000000057   Transcript: ENSTGUT00000000060
Sequence length 1016
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:368896:381725:-1 gene:ENSTGUG00000000057 transcript:ENSTGUT00000000060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLAASHSAEEASFEHTVELQGITFNSSLQMENSDYYRVLTPALERLLHRLHHPGLQPLSS
TLEEEAFRHGLAAALHKQGLSLAAYGTISSASLTGMALLPLPARQSSQGFVPRSTYAKST
HKAEAAFPTCPQEHDPDALTFSSLSDCGSRPAMQTASRIVGGSEASRGEFPWQVSLRENN
EHFCGAAILTEKWLVSAAHCFTEFQDPAMWAAYTGTTSLRGSDSSAVKMDISQIIPHPSY
NADTADYDVAVLELKKPVTFTKYIQPVCLPDAGHHFPTSKKCLISGWGYLKEDFLVKPEF
LQKATVELLDQNLCSSLYSHVLTDRMMCAGYLEGKVDSCQGDSGGPLVCQEPSGRFFLAG
IVSWGIGCAEARRPGVYTRVTKLRDWILDAISAFPTSMVRTVPPMHFRTSSNMANAEDVN
TTTRATPTTFPAPAASRPATAAGPQECGRRPGFSKPSKIVGGTDASRGEIPWQVSLKEDS
RHFCGATIIGDRWLLSAAHCFNETIPEEIEAYVGTTSINGTDENAVKVNVTRVIPHPLFN
PMILDFDVAVLELARPLVFNKYIQPVCLPLAMQKFPVGKKCLISGWGDLQEGNDTKPESL
QKASVGIIEQNTCNFLYNFSLTDRMICAGFMEGMVDSCQGDSGGPLACEVTPGVFYLAGI
VSWGFGCAQAMRPGVYSRITRLTDWILDTISHIPPSSAIPRTSTTAIFIQPSTMAAGPAN
RTTLETKISTTMSETSTALRTTETAKPTQTPGKTAEPVHPNTRSLHTTSLEDCGSTTALA
FSKIVGGSSAARGEWPWQVSLWLQRKEHKCGAVLIADRWLLSAAHCFNIYSDPKMWVAFL
GTPFLSGIDGKMEKIFRIYKHPFYNVYSLDYDVALLELSTPVTFSSTIRPICLPDNSHIF
REGARCFITGWGSTKEGGLMSKHLQKAAVNMIGDQACKKFYPVQISSRMLCAGFPQGTVD
SCSGDAGGPLACKEPSGKWFLAGITSWGYGCARPYFPGVYTKVTAVQGWIVQNLKL
Download sequence
Identical sequences H0YP63
ENSTGUP00000000060 ENSTGUP00000000060 59729.ENSTGUP00000000060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]