SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000107 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000107
Domain Number 1 Region: 139-421,508-626
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0011
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily UBA-like 2.35e-16
Family UBA domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000107   Gene: ENSTGUG00000000099   Transcript: ENSTGUT00000000107
Sequence length 1057
Comment pep:known_by_projection chromosome:taeGut3.2.4:24:259836:277793:-1 gene:ENSTGUG00000000099 transcript:ENSTGUT00000000107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQVLLNQMKEITGIQDSAFLLAALKAADGDLMEAVTFLTEDPAPEPVQSPAAAELSAWEG
STVGKQLPQGALNSAPHNQDNLRTANTVRPLESPKAPAAESDAAERSDAHSAENKNRSKR
KRCEAWGENSKQNDWRRAGDWPVGMKNIGNTCWFSAVIQSLFQLPEFRRLVLGYSLPQNV
LESCRSHTGKRNIAFMQELQCLFALMLGTWRKFVDPSAALELLRDVFRSSEQPQQDVSEF
THKLLDWLEDAFQLTVNVTSLGDKSENPMVQLFYGTFLTEGVHKGNTFSKIETFGQYPLQ
VNGYRNLNECLEGAMVEGEMDETPASQSVKYGQERWFTKLPPVLTFELSRFEFNQSLGQP
EKIHTKLEFPQTIYMDRYLYCNKDLIQMKREEMKRLKEKMVTLQQKLERYMEYGSGPARF
PLPDMLQYVLEFIATKPARHSCAPKPSLIMVGDFSSAHCESVLRDIQERTDTRTEDEAFF
VANSSPQQSSSMELQPPVSPAELSERPAPHVVSKEELNLVQTCLQRWRNEIEQDVQDLKE
SIARINLSIEQMYCDPLLQQVPYRLHAVLVHEGQANAGHYWAFIYDQPRKRWLKYNDISV
TESSWEELERESFGGLRNASAYCLMYISDQVSPVDEDESPEARQFQKEVEALSPELRHYI
QEDNWRLEQEAEEWDEEQSCKIPQMEPSPTSELQDLSSESGPGTAAGHYVHSLSSEHARI
AKEQTAKAIANTADAYEKNGVEAALCEVMLSPAMQGVILAIAKARQTFDRDGSEAGLVKA
FHEEYSRLYLLSKETPTPQNDARLQHVLIYFLQNNAPQQVVERTLLEQFADKNLSYDERS
ISIMKVARAKLSEIGPDDVDMEEYKRWHEDYSLFRKVSIYLLTGLELYQNRKYQESLTYL
VYAYQSNTKLLLKGANRGVSESLIALYRRKCLLKLNEVAASLFVSCEEAHVSEGVSILNE
LIIPCMHLMSNLAVSQEDLDAIEVMRNRWCSYLGREDMDAKLQMKLGELLPRLLDGSTEV
IMLKEPPKIRPNSPYDLCSRFAAVMESIHGASAVTVN
Download sequence
Identical sequences H0YPB0
ENSTGUP00000000107 59729.ENSTGUP00000000107 ENSTGUP00000000107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]