SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000111 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000111
Domain Number 1 Region: 240-414
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-53
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000029
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000111   Gene: ENSTGUG00000000103   Transcript: ENSTGUT00000000112
Sequence length 420
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:2005386:2015475:1 gene:ENSTGUG00000000103 transcript:ENSTGUT00000000112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCGAHAGRPLELFCEDCGRCVCALCPALGAHRGHRACLLPQAVRRTQELMSVCLKNLEER
KEEEDGNRRSIEQAVKDVKAHADMMKRQLSEKMAELQLLLREEESLAKNFIDEKTQQALG
THDQHLRFCQEQLAALETFTHRIRQIQQDSDPIHLLEKYMEIEKEIKESRHPSEKWHPVP
LSFEHLLNHYKHFLRVLQSILQKPLEARLKEDVFSSLNPTAKKEPGTVLKTMTPIDRLLF
LKHARSPTWEYDSIHPRLKLSDDRLEVSCSWRRIFYPCNPQRFDKLWQVLSRDAFLSGSH
YWEVDLLQAGAGWWIGAAYPTIGRKGDSEACRLGWNRASWCLKKFDFEYWAFHKGERIPI
RIEDDPDRIGVFLDYEAGILSFYNVSNGMAHLHTFCCKFTEPVYPALRLWEGSIRTCKLT
Download sequence
Identical sequences H0YPB4
ENSTGUP00000000111 59729.ENSTGUP00000000111 ENSTGUP00000000111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]