SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000119 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000119
Domain Number 1 Region: 8-100
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-23
Family Canonical RBD 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000119   Gene: ENSTGUG00000000117   Transcript: ENSTGUT00000000121
Sequence length 273
Comment pep:novel chromosome:taeGut3.2.4:24:369947:371903:1 gene:ENSTGUG00000000117 transcript:ENSTGUT00000000121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAAEANRTLFVGNLDPKVTEELIFELFHQAGPVITVKIPKDRDGRPKQFAFVNFKHE
ESVPYGLRLLNGILYGRPMRIQFRSGSSHAAQDINPSCSQLGSAGTSPPGMPHPASNCSR
VPDGMAALGYPPSLQRQAVVRAHTHGLSLGGRLGGLWAYEQPGFASPGYPHSFHALPGSP
GPRRPEGPALRKARLGAHPYSPDSRHFGRERFGDPDYGRGKRDEYGFEERGHEAEHHYRG
GREEHYDDRHRDSWSYEYRRESYREPKWHSARH
Download sequence
Identical sequences H0YPC2
59729.ENSTGUP00000000119 ENSTGUP00000000119 ENSTGUP00000000119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]