SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000131 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000131
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000095
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000131
Domain Number - Region: 148-221
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00185
Family Ubiquitin-related 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000131   Gene: ENSTGUG00000000132   Transcript: ENSTGUT00000000133
Sequence length 245
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:2615125:2632075:-1 gene:ENSTGUG00000000132 transcript:ENSTGUT00000000133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPKMLTRKIKLWDINAHITCRLCNGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRI
VIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMKKQREFYHKLGMEVPGDIKGETCSTKQ
HLDSHRNGETKADENINKETSEEKQEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCS
AQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRP
KMDLL
Download sequence
Identical sequences H0YPD4
ENSTGUP00000000131 ENSTGUP00000000131 59729.ENSTGUP00000000131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]