SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000170 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000170
Domain Number 1 Region: 69-178
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000173
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000170   Gene: ENSTGUG00000000168   Transcript: ENSTGUT00000000173
Sequence length 181
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:895227:896514:-1 gene:ENSTGUG00000000168 transcript:ENSTGUT00000000173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGQEPPEPPGPAAPRPSRARPRLVFHTQLAHGSPTGRIEGFTNVKELYAKIAEVFDISPT
EILFCTLNTHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYA
FIIKEGSIINRLQTVCVGESIEAINDHTIVGCRHYEVARMLRELPRAQPFTLRLVQPKKA
F
Download sequence
Identical sequences H0YPH2
ENSTGUP00000000170 ENSTGUP00000000170 59729.ENSTGUP00000000170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]