SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000195 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000195
Domain Number 1 Region: 350-454
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.89e-30
Family Transforming growth factor (TGF)-beta 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000195   Gene: ENSTGUG00000000194   Transcript: ENSTGUT00000000198
Sequence length 454
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:1163820:1166642:-1 gene:ENSTGUG00000000194 transcript:ENSTGUT00000000198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTWRICVCLSCCLPWLSAGTQFSPRSRGREDSAEAPGFLAAPEDAANQLSAGLQLPQG
EAPAHALLPPLLKVLHNRGPRGWHSEAPRLQPDSRALRYMKRLYRMSATRDGIPKAQRGR
LYNTVRLFTPCWECEHRPAHLGKGDVHSVDFLFNLDHVTALEHLLKSVLLYSFDTSVPIS
SSITCMCHLSLKEHDFSSQVCPSISHSLAFSLHFDVRKRKWVEMDVTSFLQPLIAMNRRN
VHMALNFTCLMGDPQGSTKLENAVNVTLVPPSLLLYLNDTSEQAYHRGSSLRHGRKSSSP
LVDPPKGDRGQGNPQGKRASRQRRNENPKAAPATSARNLSEYLKQFVFPQNECELHSFRL
SFSQLRWDRWIIAPHRYSPQFCRGECPRALGHRYGSPVHTMVQTLIYERLDPSVPRPSCV
PAAYSPLSVLTIEPDGSIVYKEYEDMIATKCTCR
Download sequence
Identical sequences H0YPJ6
ENSTGUP00000000195 59729.ENSTGUP00000000195 ENSTGUP00000000195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]