SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000229 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000229
Domain Number 1 Region: 84-321
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.87e-81
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 16-92
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000458
Family Hepsin, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000229   Gene: ENSTGUG00000000220   Transcript: ENSTGUT00000000233
Sequence length 322
Comment pep:known_by_projection chromosome:taeGut3.2.4:24:1090237:1093351:1 gene:ENSTGUG00000000220 transcript:ENSTGUT00000000233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRSILQVLQSRTQTGSCVCHDHFTPAPARAACEQMGYSSTPAFQGVEVSAGQPLPPREVV
LSNGSLQVLEPGRKCLSGLVVSLFCSNCGQSVRTTRVLGGSPAAIEAWPWQVSLQYRKEH
ICGGSIIGPGWVLTAAHCFTNNPIIQSWRVKAGSDLLSGAATIAVEKVFLAEVTPASPKD
NDIALVKLRSPVHDSDSTKPICLPYFDEELVPGTPLWVIGWGYTEEHGKLSEHLQQAEVE
LIDKRSCNLAAYHGDVTDRMLCAGLPQGGVDTCQGDSGGPLLYSGGHWQVVGIVSWGQGC
GTPSTPGVYTSVRAYLDWIYAV
Download sequence
Identical sequences H0YPM9
59729.ENSTGUP00000000229 ENSTGUP00000000229 ENSTGUP00000000229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]