SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000253 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000253
Domain Number 1 Region: 66-176
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 6.62e-31
Family Interleukin 17F, IL-17F 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000253   Gene: ENSTGUG00000000251   Transcript: ENSTGUT00000000257
Sequence length 176
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:1657614:1658270:1 gene:ENSTGUG00000000251 transcript:ENSTGUT00000000257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLLLCIFTFAMVVPEAKEQSRAAKGRRRGLARPPTAPPAMAWAPEEPYSSVAEYEHSIQD
MVRQLRNGSQPGDTKCQVNLRLWRSNRRSLSPWAYRINHDARRIPADIPEARCLCRGCIN
PFSMQEDRSMASVPIYSRLPVRRRLCPAPRPPGTKRCPKKYQLVMEAIAVGCTCIF
Download sequence
Identical sequences H0YPQ3
ENSTGUP00000000253 ENSTGUP00000000253 59729.ENSTGUP00000000253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]