SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000265 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000265
Domain Number 1 Region: 175-191,225-295
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000174
Family Haloperoxidase 0.069
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000265
Domain Number - Region: 91-125
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00338
Family Eukaryotic proteases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000265   Gene: ENSTGUG00000000257   Transcript: ENSTGUT00000000269
Sequence length 300
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:1371890:1373593:-1 gene:ENSTGUG00000000257 transcript:ENSTGUT00000000269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLSISQLCCLFCCPPCPSRIAAKLAFLPPEPTYAMVPEPEGSTGSLRGAAGRWKLHLK
DRADFQYSQRELDNIEVFVTKSSRGNRVGCMYVRCVPGASQTCRDSSGCPLQCSSFPCGI
TSWPHCPSDFAHQLRGCAAGSSSGWYSEEQLFLCLSLAARPVGPRGQSPGRKLSHGDVVT
AVCSLSVTPGQIFSLAEALCLPLSLSGNVSFPVLTPSLFPIHPLGSIEKISKITSPVLII
HGTEDEVIDFSHGLALFERCPKAVEPLWVDGAGHNDIELYSQYLERLRKFISQELASQRN
Download sequence
Identical sequences H0YPR5
59729.ENSTGUP00000000265 ENSTGUP00000000265 ENSTGUP00000000265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]