SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000291 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000291
Domain Number 1 Region: 117-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.88e-17
Family Ubiquitin-related 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000291   Gene: ENSTGUG00000000288   Transcript: ENSTGUT00000000296
Sequence length 211
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:1940158:1962013:1 gene:ENSTGUG00000000288 transcript:ENSTGUT00000000296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFES
NDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKGDLETLDIPD
PPPNSGHECQLRLRLSTGKDLKLQVRSMDSVYHMKRRLHAVEGVEPGSQRWFFSGRPLAD
KMKLEELKIPKDYVVQVIVSQPLANPTPVEN
Download sequence
Identical sequences H0YPU1
59729.ENSTGUP00000000291 ENSTGUP00000000291 ENSTGUP00000000291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]