SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000321 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000321
Domain Number 1 Region: 16-150
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.89e-27
Family Calponin-homology domain, CH-domain 0.00099
Further Details:      
 
Domain Number 2 Region: 629-707
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-22
Family DIX domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000321   Gene: ENSTGUG00000000315   Transcript: ENSTGUT00000000326
Sequence length 712
Comment pep:known chromosome:taeGut3.2.4:24:1594152:1628242:-1 gene:ENSTGUG00000000315 transcript:ENSTGUT00000000326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLACLARGNLLDFLHEGFTEQQLQAYVAWVNSQLKKKPAVRPVQDLRQDLRDGVTLALLI
EIVGQCCRPVLVFPLMSPSDKAFSLPPAGEKLSGIELNPSSQQEMRENVEKVLQFVASRK
IRMHQTSAKDIVEGNLKSTMRLILALAAHFKPGSGRAGTPGSGGRSRAAAPGSVRPRSAA
AVAQGAVAALADVRQDVQQSGRDLFRHRQRNSSMDEEIENPYWSVRALVQQYEGQQNVPL
ESHPASLTSPSPVHSAKSESTVAPLEEKERLVILQTEEAEPKAEEADSHFQPEWQAGSSG
SYLENSWEEQLLEQQDHLEKEMEEAKKMISGLQALLLNGSLPEDEQEGSFELSERGACPE
EQLIIIRSRLDQSVEENQDLKKELLKYKQEARNLQGIKDALQQRLLQQDAAVLQLKQELL
RANMDKEELHNQNVDLQRKVEERNRLLAEYKKELCQKDRHLQQHQTKLDEMLRQLSEASY
QQVDLERELEHREALLAHCMKREAEEVMAYSSHSAQSNGFLQPAGKGAAPTAHRGVSTSD
LQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHRLETQKRQERRVRGKSPASR
ASNECRDSWPPKSKLPHSQSTPVMSTSACTKVLYFTDRSLTPFMVSIPKRLGEVTLKDFK
AAIDREGTHRYHFKALDPEFGTVKEEVFHDDDIIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences H0YPX1
59729.ENSTGUP00000000321 ENSTGUP00000000321 ENSTGUP00000000321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]