SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000349 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000349
Domain Number 1 Region: 2-228,720-757
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.4e-85
Family Protein kinases, catalytic subunit 0.0000209
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000349
Domain Number - Region: 243-289
Classification Level Classification E-value
Superfamily UBA-like 0.0335
Family UBA domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000349   Gene: ENSTGUG00000000335   Transcript: ENSTGUT00000000354
Sequence length 872
Comment pep:novel chromosome:taeGut3.2.4:24:1697643:1727139:-1 gene:ENSTGUG00000000335 transcript:ENSTGUT00000000354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEFAKNGEI
FDYLASHGRLSEAEARRKFWQILSAVEYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFG
NFYKSGEPLTTWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPI
LRQRVLEGRFRIPYFMSEECEHLIRRMLVLDPSKRLSIAQIKEHKWMLVEVPAQRPILYP
PGEENEPSLGEYNEQVLRLMHSLGIDQQKTVESLQNKSYNHFAAIYYLLVERLKSHRSSF
PVEQRVDARQRRPSTIAEQTVAKAQAVVPSVNLHSQNPRLLQSPGLPSASGAETFSFPPS
SCQGEAAFMEEERVETPKVNGCLLDPVPPVVMRKGCQSLPSSMMETSIDEGIEAEGEAEE
DPAQAFAALQAARGGKRRHTLAEVTNQLVMVPGTGKVYSLDENSSLSSIDSEYDMGSVQR
DLKFLGETPSLKEMVLSSQQPPRVTSPFLGLRPANPAMQALSSQKREAHNRSPVSFREGR
RASDTSLTQGIVAFRQHLQNLARTKGILELNKVQLLYEQMGSEEEPSLTSAATQLQELIN
SPAQERMPQQQEAPAAFPNSHPPLLSRRQSLETQYLNRLQKPTLLSKAPNTCQLYCKELP
RSLEQQLQEHRLHQKRLFLQKQSQLQAYFNQMQIAESSYPQASPLPLPCPEELQPQQQQQ
QQQPQQQQQQQQQPAHPVLEPSSGQLHFEPFLRQYPKLEPLPPSPSRLTAPAPQQQQQQQ
QPAHPSRLSPPGQGQPAQPLQFPYQTCELPAVPSAEQCHLPQSSAALPESQSSSAEAQPS
YDSLALSELPGLFDCEMMEAVDPQHGGYVLVN
Download sequence
Identical sequences H0YPZ7
ENSTGUP00000000349 59729.ENSTGUP00000000349 ENSTGUP00000000349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]