SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000383 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000383
Domain Number 1 Region: 35-161
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.05e-58
Family N-terminal domain of cbl (N-cbl) 0.000000193
Further Details:      
 
Domain Number 2 Region: 248-334
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 340-418
Classification Level Classification E-value
Superfamily RING/U-box 5.96e-43
Family RING finger domain, C3HC4 0.00000906
Further Details:      
 
Domain Number 4 Region: 162-247
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 862-896
Classification Level Classification E-value
Superfamily UBA-like 0.0000158
Family UBA domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000383   Gene: ENSTGUG00000000375   Transcript: ENSTGUT00000000388
Sequence length 909
Comment pep:novel chromosome:taeGut3.2.4:24:1915428:1947624:1 gene:ENSTGUG00000000375 transcript:ENSTGUT00000000388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPLKKGPGGLIGLMKDAFQPHHHHLGPHQPGAVDKKMVEKCWKLMDKVVRLCQNPKLA
LKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEG
KERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGE
KTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLR
NWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQ
TIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGS
TFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFDP
RGGGGLSRQGAEGTPSPNYDDDDDDKADDSLFMMKELAGTKVERPPSPFSLAPQAALPPV
PPRLDLLQQRVANPPGASSPGTTSKAAPGALHKDKPLPIPPTLRDLPPPPPPDRPHALGT
SLGTSLGTSLGTSEGRPQRRPLPCTPGDCPTRDKPPPLPSGRQGEPWPGRPMPKAPAVGT
AEPWAGRELSNRHSLPFSLPSQLESRLGSTLSLDGPASSSSGPAATSECEHPKIKPSSSA
NAIYSLAARPLPVPKLPPGEQSESDEDTEYMSPSSLPVVPPGPAVQKPELKMPLEMTQSL
RVLDCDQQPEGSMYEAMYNIHSQAASSAFEAVTTSDEGNLAAGSASNGPEESENEEDGYD
VPKPPLPVASARRTLSDISNATPAFSRMSLENDPATGFSEGSQVPERPPKPLPRRINSER
KAGSCQAGGASSGASSSLHLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVS
ISSPAHVAT
Download sequence
Identical sequences H0YQ30
XP_002193659.1.42559 59729.ENSTGUP00000000383 ENSTGUP00000000383 ENSTGUP00000000383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]