SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000385 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000385
Domain Number 1 Region: 3-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.23e-69
Family Lectin leg-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000385   Gene: ENSTGUG00000000376   Transcript: ENSTGUT00000000390
Sequence length 296
Comment pep:known chromosome:taeGut3.2.4:13:3380647:3384425:-1 gene:ENSTGUG00000000376 transcript:ENSTGUT00000000390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRPFTGAGSAAMPLWDFTGSTMVTSQYVRLTPDERSREGSIWNRVPCFLKDWELHVHFRI
HGAGKKNLHGDGLALWYTQERLTPGPVFGSKDNFHGLAIFLDTYPNDEATERVFPYISAM
VNNGSLTYEHSKDGRGTELAGCSADLRNQNHDTFLAVRYSRGRLTVMTDVEDKNEWKNCI
DIAGVQLPTGYFFGASAGTGDLSDNHDIISMKLFQLMVEHPLEDETVDWTKIEPRVSLLK
SPKDNVDDPTGNFRSGPLTGWKVFLLLLCALLGIIVCAVVGAVVFQKRQERNKRFY
Download sequence
Identical sequences H0YQ32
ENSTGUP00000000385 59729.ENSTGUP00000000385 ENSTGUP00000000385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]